PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050761001
Common NameGSBRNA2T00050761001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 339aa    MW: 37838.6 Da    PI: 6.4585
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050761001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32178232155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k r+rWtpeLHe+Fveav+qLGG e+A Pk++l++mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00050761001 178 KGRVRWTPELHEAFVEAVNQLGGMENAKPKAVLKHMKVQGLTIYHVKSHLQKYRT 232
                          569***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.732175235IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-30176233IPR009057Homeodomain-like
SuperFamilySSF466891.15E-17176232IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-22178232IPR006447Myb domain, plants
PfamPF002491.2E-10180231IPR001005SANT/Myb domain
PfamPF143797.4E-19264309IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
METCPFRSMS SLALTSSVPN PSVNADISFS SEHNQSMASP YHLLSANGGA VGHNIYSNDL  60
HNHPSMASHI GSSTPIPDLF DFPLDIPIQT NQMDDIHRPS ELAELDEELI TDDENPLMSA  120
LLNDLFLDTS STSAASKVQE PTMQSQIQQP QVVLHQTSPI VRTVSSNSFT SNNTAATKGR  180
VRWTPELHEA FVEAVNQLGG MENAKPKAVL KHMKVQGLTI YHVKSHLQKY RTARHVPEPS  240
EAGWREKKLT PVEHVTSLDT KSGMYISEAL RIQMEVQKQL HEQLEIQRKM QLQIEKQGKA  300
LVMMIEKQNM EFGKPEQEEE AGADSRRSKR PKVSRNDR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1325332RRSKRPKV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.243481e-139leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00111ampDAPTransfer from AT2G20400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050761001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652700.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_013652699.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN59e-63PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078H3A00.0A0A078H3A0_BRANA; BnaA07g00280D protein
STRINGBra036469.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20400.11e-112G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]